Lineage for d5abta1 (5abt A:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827668Species Salmonella enterica [TaxId:28901] [276471] (19 PDB entries)
  8. 2827672Domain d5abta1: 5abt A:1-245 [323189]
    Other proteins in same PDB: d5abta2
    automated match to d5a5wa_
    complexed with guo; mutant

Details for d5abta1

PDB Entry: 5abt (more details), 1.65 Å

PDB Description: s.enterica hisa mutant d7n, g102a, v106m, d176a
PDB Compounds: (A:) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylidene amino] imidazole-4-carboxamide isomerase

SCOPe Domain Sequences for d5abta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abta1 c.1.2.0 (A:1-245) automated matches {Salmonella enterica [TaxId: 28901]}
miipalnlidgtvvrlhqgdyarqrdygndplprlqdyaaqgagvlhlvdltgakdpakr
qipliktlvagvnvpvqvgggvrteedvaallkagvarvviastamkspdvvkgwferfg
aqalvlaldvridehgtkqvavsgwqensgvsleqlvetylpvglkhvlctdisragtla
gsnvslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvkeaiq
cwqnv

SCOPe Domain Coordinates for d5abta1:

Click to download the PDB-style file with coordinates for d5abta1.
(The format of our PDB-style files is described here.)

Timeline for d5abta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5abta2