| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Second domain of the Flt-1 receptor [49188] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49189] (6 PDB entries) |
| Domain d5abdx_: 5abd X: [323188] automated match to d1fltx_ complexed with cu, na, so4 |
PDB Entry: 5abd (more details), 2 Å
SCOPe Domain Sequences for d5abdx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5abdx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
grpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkg
fiisnatykeiglltceatvnghlyktnylthrqt
Timeline for d5abdx_: