| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries) Uniprot P08263 |
| Domain d5lcza2: 5lcz A:81-210 [323185] Other proteins in same PDB: d5lcza1, d5lczb1 automated match to d1f3aa1 complexed with gsh |
PDB Entry: 5lcz (more details), 2.33 Å
SCOPe Domain Sequences for d5lcza2:
Sequence, based on SEQRES records: (download)
>d5lcza2 a.45.1.1 (A:81-210) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdmkeralidmysegildltemiiqlvicppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflqp
gsqrkpamda
>d5lcza2 a.45.1.1 (A:81-210) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdmkeralidmysegildltemitalakdrtknrylpafekvlkshgqdylvgnrlt
rvdihllelllyveefdaslltsfpllkafksrisslpnvkkflqpgsqrkpamda
Timeline for d5lcza2: