Lineage for d5lcza2 (5lcz A:81-210)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2321907Protein Class alpha GST [81349] (8 species)
  7. 2321920Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (34 PDB entries)
    Uniprot P08263
  8. 2321998Domain d5lcza2: 5lcz A:81-210 [323185]
    Other proteins in same PDB: d5lcza1, d5lczb1
    automated match to d1f3aa1
    complexed with gsh

Details for d5lcza2

PDB Entry: 5lcz (more details), 2.33 Å

PDB Description: chimeric gst
PDB Compounds: (A:) Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1

SCOPe Domain Sequences for d5lcza2:

Sequence, based on SEQRES records: (download)

>d5lcza2 a.45.1.1 (A:81-210) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdmkeralidmysegildltemiiqlvicppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflqp
gsqrkpamda

Sequence, based on observed residues (ATOM records): (download)

>d5lcza2 a.45.1.1 (A:81-210) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdmkeralidmysegildltemitalakdrtknrylpafekvlkshgqdylvgnrlt
rvdihllelllyveefdaslltsfpllkafksrisslpnvkkflqpgsqrkpamda

SCOPe Domain Coordinates for d5lcza2:

Click to download the PDB-style file with coordinates for d5lcza2.
(The format of our PDB-style files is described here.)

Timeline for d5lcza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5lcza1