Lineage for d5l9oa_ (5l9o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915183Species Agrobacterium fabrum [TaxId:176299] [258501] (12 PDB entries)
  8. 2915195Domain d5l9oa_: 5l9o A: [323183]
    Other proteins in same PDB: d5l9ob2
    automated match to d4eq9a_
    complexed with ca, edo, gop

Details for d5l9oa_

PDB Entry: 5l9o (more details), 1.84 Å

PDB Description: crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine
PDB Compounds: (A:) Deoxyfructosyl-amino Acid Transporter Periplasmic Binding Protein

SCOPe Domain Sequences for d5l9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l9oa_ c.94.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
dnplglidpttisvgtmgdakpyafttadgnftgfdielflnvagrlgfkkeqvvftgqe
fsalmpsvangrfdvaaaaigttakrketvdfsdgylagflsvltseagitdaaglkgkr
lgvvqgtlqeiyaeknfagtdlvkfpdnnsavsalnngtvdahfldfeaakdysarypal
kiavnipsfdapagfvirkgndalrnaldkglkeamqdgtwkklhekwfpgtpmpaaylp
k

SCOPe Domain Coordinates for d5l9oa_:

Click to download the PDB-style file with coordinates for d5l9oa_.
(The format of our PDB-style files is described here.)

Timeline for d5l9oa_: