![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Agrobacterium fabrum [TaxId:176299] [258501] (12 PDB entries) |
![]() | Domain d5l9oa_: 5l9o A: [323183] Other proteins in same PDB: d5l9ob2 automated match to d4eq9a_ complexed with ca, edo, gop |
PDB Entry: 5l9o (more details), 1.84 Å
SCOPe Domain Sequences for d5l9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l9oa_ c.94.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]} dnplglidpttisvgtmgdakpyafttadgnftgfdielflnvagrlgfkkeqvvftgqe fsalmpsvangrfdvaaaaigttakrketvdfsdgylagflsvltseagitdaaglkgkr lgvvqgtlqeiyaeknfagtdlvkfpdnnsavsalnngtvdahfldfeaakdysarypal kiavnipsfdapagfvirkgndalrnaldkglkeamqdgtwkklhekwfpgtpmpaaylp k
Timeline for d5l9oa_: