| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
| Protein automated matches [190393] (12 species) not a true protein |
| Species Caldalkalibacillus thermarum [TaxId:986075] [322910] (2 PDB entries) |
| Domain d5ik2b2: 5ik2 B:96-371 [323171] Other proteins in same PDB: d5ik2a1, d5ik2a3, d5ik2b1, d5ik2b3, d5ik2c1, d5ik2c3, d5ik2d1, d5ik2d3, d5ik2e1, d5ik2e3, d5ik2f1, d5ik2f3, d5ik2g_, d5ik2i1, d5ik2i3, d5ik2j1, d5ik2j3, d5ik2k1, d5ik2k3, d5ik2l1, d5ik2l3, d5ik2m1, d5ik2m3, d5ik2n1, d5ik2n3, d5ik2o_ automated match to d1skyb3 complexed with adp, gol, mg, po4; mutant |
PDB Entry: 5ik2 (more details), 2.6 Å
SCOPe Domain Sequences for d5ik2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik2b2 c.37.1.11 (B:96-371) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
evpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvheplqtgikaids
mipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstvagvvetlrqh
daldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskqaaayrelsl
llrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdvsayiptnvi
sitdgqiflesdlfysgvrpavnvgisvsrvggaaq
Timeline for d5ik2b2:
View in 3DDomains from other chains: (mouse over for more information) d5ik2a1, d5ik2a2, d5ik2a3, d5ik2c1, d5ik2c2, d5ik2c3, d5ik2d1, d5ik2d2, d5ik2d3, d5ik2e1, d5ik2e2, d5ik2e3, d5ik2f1, d5ik2f2, d5ik2f3, d5ik2g_, d5ik2i1, d5ik2i2, d5ik2i3, d5ik2j1, d5ik2j2, d5ik2j3, d5ik2k1, d5ik2k2, d5ik2k3, d5ik2l1, d5ik2l2, d5ik2l3, d5ik2m1, d5ik2m2, d5ik2m3, d5ik2n1, d5ik2n2, d5ik2n3, d5ik2o_ |