Lineage for d5ik2b2 (5ik2 B:96-371)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869998Protein automated matches [190393] (12 species)
    not a true protein
  7. 2870003Species Caldalkalibacillus thermarum [TaxId:986075] [322910] (2 PDB entries)
  8. 2870005Domain d5ik2b2: 5ik2 B:96-371 [323171]
    Other proteins in same PDB: d5ik2a1, d5ik2a3, d5ik2b1, d5ik2b3, d5ik2c1, d5ik2c3, d5ik2d1, d5ik2d3, d5ik2e1, d5ik2e3, d5ik2f1, d5ik2f3, d5ik2g_, d5ik2i1, d5ik2i3, d5ik2j1, d5ik2j3, d5ik2k1, d5ik2k3, d5ik2l1, d5ik2l3, d5ik2m1, d5ik2m3, d5ik2n1, d5ik2n3, d5ik2o_
    automated match to d1skyb3
    complexed with adp, gol, mg, po4; mutant

Details for d5ik2b2

PDB Entry: 5ik2 (more details), 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)
PDB Compounds: (B:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5ik2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ik2b2 c.37.1.11 (B:96-371) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
evpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvheplqtgikaids
mipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstvagvvetlrqh
daldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskqaaayrelsl
llrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdvsayiptnvi
sitdgqiflesdlfysgvrpavnvgisvsrvggaaq

SCOPe Domain Coordinates for d5ik2b2:

Click to download the PDB-style file with coordinates for d5ik2b2.
(The format of our PDB-style files is described here.)

Timeline for d5ik2b2: