![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
![]() | Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52679] (7 PDB entries) |
![]() | Domain d1e79d3: 1e79 D:82-357 [32317] Other proteins in same PDB: d1e79a1, d1e79a2, d1e79b1, d1e79b2, d1e79c1, d1e79c2, d1e79d1, d1e79d2, d1e79e1, d1e79e2, d1e79f1, d1e79f2, d1e79g_, d1e79h1, d1e79h2, d1e79i_ |
PDB Entry: 1e79 (more details), 2.4 Å
SCOP Domain Sequences for d1e79d3:
Sequence, based on SEQRES records: (download)
>d1e79d3 c.37.1.11 (D:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhxmi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
>d1e79d3 c.37.1.11 (D:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhmie sgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrft qagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpap attfahldattvlsraiaelgiypavdpldstsri
Timeline for d1e79d3: