| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d5ks9f2: 5ks9 F:130-256 [323169] Other proteins in same PDB: d5ks9a1, d5ks9b1, d5ks9b2, d5ks9c1, d5ks9d1, d5ks9d2, d5ks9e1, d5ks9f1, d5ks9g1, d5ks9h1 automated match to d3of6b2 complexed with ca, nag |
PDB Entry: 5ks9 (more details), 2.55 Å
SCOPe Domain Sequences for d5ks9f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ks9f2 b.1.1.2 (F:130-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra
Timeline for d5ks9f2: