Lineage for d5ks9f2 (5ks9 F:130-256)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751097Domain d5ks9f2: 5ks9 F:130-256 [323169]
    Other proteins in same PDB: d5ks9a1, d5ks9b1, d5ks9b2, d5ks9c1, d5ks9d1, d5ks9d2, d5ks9e1, d5ks9f1, d5ks9g1, d5ks9h1
    automated match to d3of6b2
    complexed with ca, nag

Details for d5ks9f2

PDB Entry: 5ks9 (more details), 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex
PDB Compounds: (F:) Bel502 TCR beta TRBV9*01

SCOPe Domain Sequences for d5ks9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ks9f2 b.1.1.2 (F:130-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

SCOPe Domain Coordinates for d5ks9f2:

Click to download the PDB-style file with coordinates for d5ks9f2.
(The format of our PDB-style files is described here.)

Timeline for d5ks9f2: