Lineage for d5ks9f1 (5ks9 F:3-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756822Domain d5ks9f1: 5ks9 F:3-129 [323168]
    Other proteins in same PDB: d5ks9a1, d5ks9a2, d5ks9b1, d5ks9c1, d5ks9c2, d5ks9d1, d5ks9e2, d5ks9f2, d5ks9g2, d5ks9h2
    automated match to d3of6c1
    complexed with ca, nag

Details for d5ks9f1

PDB Entry: 5ks9 (more details), 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex
PDB Compounds: (F:) Bel502 TCR beta TRBV9*01

SCOPe Domain Sequences for d5ks9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ks9f1 b.1.1.0 (F:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
rfsaqqfpdlhselnlsslelgdsalyfcassvapgsdtqyfgpgtrltvled

SCOPe Domain Coordinates for d5ks9f1:

Click to download the PDB-style file with coordinates for d5ks9f1.
(The format of our PDB-style files is described here.)

Timeline for d5ks9f1: