SCOPe 2.06: Domain d5loma_: 5lom A:

Lineage for d5loma_ (5lom A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Agrobacterium fabrum [TaxId:176299] [258501] (11 PDB entries)

8. Domain d5loma_: 5lom A: [323167]
   Other proteins in same PDB: d5lomb2, d5lomb3
   automated match to d4eq9a_
   complexed with edo, snw

Details for d5loma_

PDB Entry: 5lom, 1.5 Å

PDB Description: crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution

PDB Compounds: (A:) Deoxyfructosyl-amino Acid Transporter Periplasmic Binding Protein

SCOPe Domain Sequences for d5loma_:

Sequence; same for both SEQRES and ATOM records:

>d5loma_ c.94.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
dnplglidpttisvgtmgdakpyafttadgnftgfdielflnvagrlgfkkeqvvftgqe
fsalmpsvangrfdvaaaaigttakrketvdfsdgylagflsvltseagitdaaglkgkr
lgvvqgtlqeiyaeknfagtdlvkfpdnnsavsalnngtvdahfldfeaakdysarypal
kiavnipsfdapagfvirkgndalrnaldkglkeamqdgtwkklhekwfpgtpmpaaylp
k

Timeline for d5loma_:

• d5loma_ is new in SCOPe 2.06-stable
  
• d5loma_ appears in SCOPe 2.07
  
• d5loma_ appears in the current release, SCOPe 2.08