SCOPe 2.08: Domain d5ks9a1: 5ks9 A:0-81

Lineage for d5ks9a1 (5ks9 A:0-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d5ks9a1: 5ks9 A:0-81 [323165]
   Other proteins in same PDB: d5ks9a2, d5ks9b2, d5ks9c2, d5ks9d2, d5ks9e1, d5ks9e2, d5ks9f1, d5ks9f2, d5ks9g1, d5ks9g2, d5ks9h1, d5ks9h2
   automated match to d4z7ua1
   complexed with ca, nag

Details for d5ks9a1

PDB Entry: 5ks9, 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex

PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ks9a1:

Sequence; same for both SEQRES and ATOM records:

>d5ks9a1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
altniavlkhnlnivikrsnsta

Timeline for d5ks9a1:

• d5ks9a1 first appeared in SCOPe 2.06
  
• d5ks9a1 appears in SCOPe 2.07