Lineage for d5hkkf2 (5hkk F:77-349)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126370Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2126933Protein automated matches [190393] (10 species)
    not a true protein
  7. 2126938Species Caldalkalibacillus thermarum [TaxId:986075] [322910] (2 PDB entries)
  8. 2126953Domain d5hkkf2: 5hkk F:77-349 [323158]
    Other proteins in same PDB: d5hkka1, d5hkka2, d5hkka3, d5hkkb1, d5hkkb2, d5hkkb3, d5hkkc1, d5hkkc2, d5hkkc3, d5hkkd1, d5hkkd3, d5hkke1, d5hkke3, d5hkkf1, d5hkkf3, d5hkkg_, d5hkki1, d5hkki2, d5hkki3, d5hkkj1, d5hkkj2, d5hkkj3, d5hkkk1, d5hkkk2, d5hkkk3, d5hkkl1, d5hkkl3, d5hkkm1, d5hkkm3, d5hkkn1, d5hkkn3, d5hkko_
    automated match to d2qe7d2
    complexed with adp, atp, gol, mg, po4

Details for d5hkkf2

PDB Entry: 5hkk (more details), 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)
PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d5hkkf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkkf2 c.37.1.11 (F:77-349) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
isvpvgkatlgrvfnvlgepideqgevnaeerhpihrpapefeelstadeiletgikvid
llapyakggkiglfggagvgktvliqelinnvaqehgglsvfagvgertregndlyhemk
dsgvisktsmvfgqmneppgarlrvaltgltmaeyfrdregqdvllfidnifrftqagse
vsallgrmpsavgyqptlatemgqlqeritstkkgsitsiqaiyvpaddytdpapattfa
hldattnlerklaemgiypavdplastsrilsp

SCOPe Domain Coordinates for d5hkkf2:

Click to download the PDB-style file with coordinates for d5hkkf2.
(The format of our PDB-style files is described here.)

Timeline for d5hkkf2: