SCOPe 2.07: Domain d5hkkf1: 5hkk F:2-76

Lineage for d5hkkf1 (5hkk F:2-76)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (17 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322893] (2 PDB entries)

8. Domain d5hkkf1: 5hkk F:2-76 [323157]
   Other proteins in same PDB: d5hkka2, d5hkka3, d5hkkb2, d5hkkb3, d5hkkc2, d5hkkc3, d5hkkd2, d5hkkd3, d5hkke2, d5hkke3, d5hkkf2, d5hkkf3, d5hkkg_, d5hkki2, d5hkki3, d5hkkj2, d5hkkj3, d5hkkk2, d5hkkk3, d5hkkl2, d5hkkl3, d5hkkm2, d5hkkm3, d5hkkn2, d5hkkn3, d5hkko_
   automated match to d2qe7d1
   complexed with adp, atp, gol, mg, po4

Details for d5hkkf1

PDB Entry: 5hkk, 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)

PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d5hkkf1:

Sequence; same for both SEQRES and ATOM records:

>d5hkkf1 b.49.1.0 (F:2-76) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
nkgriiqvmgpvvdiqfesgqlpdiynaitierpqggtltveaavhlgdnvvrcvamast
dglvrgleavdtgap

Timeline for d5hkkf1:

• d5hkkf1 first appeared in SCOPe 2.06
  
• d5hkkf1 appears in the current release, SCOPe 2.08