SCOPe 2.07: Domain d5lp6f1: 5lp6 F:1-76

Lineage for d5lp6f1 (5lp6 F:1-76)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (82 PDB entries)

8. Domain d5lp6f1: 5lp6 F:1-76 [323154]
   Other proteins in same PDB: d5lp6a1, d5lp6a2, d5lp6b1, d5lp6b2, d5lp6c1, d5lp6c2, d5lp6d1, d5lp6d2, d5lp6e_, d5lp6f2, d5lp6f3
   automated match to d3tiia1
   complexed with 71p, ca, cl, gdp, gtp, mes, mg

Details for d5lp6f1

PDB Entry: 5lp6, 2.9 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-thiocolchicine complex

PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5lp6f1:

Sequence; same for both SEQRES and ATOM records:

>d5lp6f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5lp6f1:

• d5lp6f1 first appeared in SCOPe 2.06