![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species) PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries) |
![]() | Domain d5t3qa1: 5t3q A:1050-1350 [323150] Other proteins in same PDB: d5t3qa2 automated match to d1r0pa_ complexed with 75h |
PDB Entry: 5t3q (more details), 2 Å
SCOPe Domain Sequences for d5t3qa1:
Sequence, based on SEQRES records: (download)
>d5t3qa1 d.144.1.7 (A:1050-1350) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehy v
>d5t3qa1 d.144.1.7 (A:1050-1350) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} tvhidlsalnpelvqavqhvvigpsslivhfnevighfgcvyhgtlldndgkkihcavks lnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirn ethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadlpvkwmale slqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdply evmlkcwhpkaemrpsfselvsrisaifstfigehyv
Timeline for d5t3qa1: