Lineage for d1e79b3 (1e79 B:95-379)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70095Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 70110Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 70114Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 70116Domain d1e79b3: 1e79 B:95-379 [32315]
    Other proteins in same PDB: d1e79a1, d1e79a2, d1e79b1, d1e79b2, d1e79c1, d1e79c2, d1e79d1, d1e79d2, d1e79e1, d1e79e2, d1e79f1, d1e79f2, d1e79g_, d1e79h1, d1e79h2, d1e79i_

Details for d1e79b3

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79b3 c.37.1.11 (B:95-379) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1e79b3:

Click to download the PDB-style file with coordinates for d1e79b3.
(The format of our PDB-style files is described here.)

Timeline for d1e79b3: