Lineage for d5kyjb1 (5kyj B:297-528)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729909Domain d5kyjb1: 5kyj B:297-528 [323147]
    Other proteins in same PDB: d5kyja1, d5kyja2, d5kyjb2, d5kyje1, d5kyje2, d5kyjf2
    automated match to d4j5xc_
    complexed with 6y8

Details for d5kyjb1

PDB Entry: 5kyj (more details), 2.8 Å

PDB Description: brain penetrant liver x receptor (lxr) modulators based on a 2,4,5,6- tetrahydropyrrolo[3,4-c]pyrazole core
PDB Compounds: (B:) Retinoic acid receptor RXR-beta

SCOPe Domain Sequences for d5kyjb1:

Sequence, based on SEQRES records: (download)

>d5kyjb1 a.123.1.1 (B:297-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eempvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakr
iphfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgai
fdrvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyck
qkypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemlea

Sequence, based on observed residues (ATOM records): (download)

>d5kyjb1 a.123.1.1 (B:297-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eempvdrileaelavedpvtnicqaadkqlftlvewakriphfsslplddqvillragwn
elliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdkte
lgclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalr
siglkclehlfffklipidtflmemlea

SCOPe Domain Coordinates for d5kyjb1:

Click to download the PDB-style file with coordinates for d5kyjb1.
(The format of our PDB-style files is described here.)

Timeline for d5kyjb1: