SCOPe 2.08: Domain d2rvfa1: 2rvf A:2-97

Lineage for d2rvfa1 (2rvf A:2-97)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Monosiga brevicollis [TaxId:81824] [323144] (1 PDB entry)

8. Domain d2rvfa1: 2rvf A:2-97 [323145]
   Other proteins in same PDB: d2rvfa2
   automated match to d1mila_

Details for d2rvfa1

PDB Entry: 2rvf

PDB Description: solution nmr structure of monosiga brevicollis crk/crkl homolog (crka1) sh2 domain

PDB Compounds: (A:) Predicted protein

SCOPe Domain Sequences for d2rvfa1:

Sequence; same for both SEQRES and ATOM records:

>d2rvfa1 d.93.1.0 (A:2-97) automated matches {Monosiga brevicollis [TaxId: 81824]}
aeaaapwyhgplsrtdaensllrmpegtflvrdstsspgdyvlscsengkvthyklsaee
gkiridthlfdnldaaitfymeheleysslkqplqr

Timeline for d2rvfa1:

• d2rvfa1 first appeared in SCOPe 2.06
  
• d2rvfa1 appears in SCOPe 2.07