Lineage for d2n9da_ (2n9d A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310154Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 2310155Family a.7.8.1: GAT domain [89010] (4 proteins)
    this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain
  6. 2310176Protein automated matches [276979] (1 species)
    not a true protein
  7. 2310177Species Human (Homo sapiens) [TaxId:9606] [276980] (2 PDB entries)
  8. 2310178Domain d2n9da_: 2n9d A: [323136]
    automated match to d2n2na_

Details for d2n9da_

PDB Entry: 2n9d (more details)

PDB Description: structure analysis of the tom1 gat domain reveals distinct ligand- specific conformational states
PDB Compounds: (A:) Target of Myb protein 1

SCOPe Domain Sequences for d2n9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9da_ a.7.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvlelipq
ianeqlteellivndnlnnvflrherferfrtgqt

SCOPe Domain Coordinates for d2n9da_:

Click to download the PDB-style file with coordinates for d2n9da_.
(The format of our PDB-style files is described here.)

Timeline for d2n9da_: