| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.8: GAT-like domain [89009] (3 families) ![]() |
| Family a.7.8.1: GAT domain [89010] (4 proteins) this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain |
| Protein automated matches [276979] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [276980] (2 PDB entries) |
| Domain d2n9da_: 2n9d A: [323136] automated match to d2n2na_ |
PDB Entry: 2n9d (more details)
SCOPe Domain Sequences for d2n9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n9da_ a.7.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvlelipq
ianeqlteellivndnlnnvflrherferfrtgqt
Timeline for d2n9da_: