SCOPe 2.08: Domain d5ik2j3: 5ik2 J:372-501

Lineage for d5ik2j3 (5ik2 J:372-501)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322897] (2 PDB entries)

8. Domain d5ik2j3: 5ik2 J:372-501 [323133]
   Other proteins in same PDB: d5ik2a1, d5ik2a2, d5ik2b1, d5ik2b2, d5ik2c1, d5ik2c2, d5ik2d1, d5ik2d2, d5ik2e1, d5ik2e2, d5ik2f1, d5ik2f2, d5ik2g_, d5ik2i1, d5ik2i2, d5ik2j1, d5ik2j2, d5ik2k1, d5ik2k2, d5ik2l1, d5ik2l2, d5ik2m1, d5ik2m2, d5ik2n1, d5ik2n2, d5ik2o_
   automated match to d1skyb1
   complexed with adp, gol, mg, po4; mutant

Details for d5ik2j3

PDB Entry: 5ik2, 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)

PDB Compounds: (J:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5ik2j3:

Sequence, based on SEQRES records:

>d5ik2j3 a.69.1.0 (J:372-501) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
ikamkkvagtlrldlaqyrelqafaqfgsdldkatqaklnrgertveilkqdehkpmpve
eqvisiyavtngfmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaai
eefkkgftps

Sequence, based on observed residues (ATOM records):

>d5ik2j3 a.69.1.0 (J:372-501) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
ikamkkvagtlrldlaqyrelqadkatqaklnrgertveilkqdehkpmpveeqvisiya
vtngfmddipvedvrrfeeellsfmrankdslldhirqtgelpdtkeldaaieefkkgft
ps

Timeline for d5ik2j3:

• d5ik2j3 first appeared in SCOPe 2.06
  
• d5ik2j3 appears in SCOPe 2.07