Lineage for d5ks9d1 (5ks9 D:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938806Domain d5ks9d1: 5ks9 D:2-92 [323122]
    Other proteins in same PDB: d5ks9a2, d5ks9b2, d5ks9c2, d5ks9d2, d5ks9e1, d5ks9e2, d5ks9f1, d5ks9f2, d5ks9g1, d5ks9g2, d5ks9h1, d5ks9h2
    automated match to d1klub2
    complexed with ca, nag

Details for d5ks9d1

PDB Entry: 5ks9 (more details), 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex
PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d5ks9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ks9d1 d.19.1.0 (D:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
nsqkevlertraeldtvcrhnyqlelrttlq

SCOPe Domain Coordinates for d5ks9d1:

Click to download the PDB-style file with coordinates for d5ks9d1.
(The format of our PDB-style files is described here.)

Timeline for d5ks9d1: