![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
![]() | Domain d5ksba1: 5ksb A:0-81 [323118] Other proteins in same PDB: d5ksba2, d5ksbb2, d5ksbc2, d5ksbd2, d5ksbe1, d5ksbe2, d5ksbf1, d5ksbf2, d5ksbg1, d5ksbg2, d5ksbh1, d5ksbh2 automated match to d4ozfa1 complexed with nag |
PDB Entry: 5ksb (more details), 2.9 Å
SCOPe Domain Sequences for d5ksba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ksba1 d.19.1.0 (A:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfa ltniavlkhnlnslikrsnsta
Timeline for d5ksba1: