Lineage for d5ijua_ (5iju A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766145Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (4 PDB entries)
  8. 2766152Domain d5ijua_: 5iju A: [323117]
    automated match to d2bena_
    complexed with ca, cu, edo

Details for d5ijua_

PDB Entry: 5iju (more details), 1.7 Å

PDB Description: structure of an aa10 lytic polysaccharide monooxygenase from bacillus amyloliquefaciens with cu(ii) bound
PDB Compounds: (A:) BaAA10 Lytic Polysaccharide Monooxygenase

SCOPe Domain Sequences for d5ijua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ijua_ b.1.18.0 (A:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt

SCOPe Domain Coordinates for d5ijua_:

Click to download the PDB-style file with coordinates for d5ijua_.
(The format of our PDB-style files is described here.)

Timeline for d5ijua_: