SCOPe 2.08: Domain d5ksbd2: 5ksb D:93-189

Lineage for d5ksbd2 (5ksb D:93-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ksbd2: 5ksb D:93-189 [323109]
   Other proteins in same PDB: d5ksba1, d5ksba2, d5ksbb1, d5ksbc1, d5ksbc2, d5ksbd1, d5ksbe2, d5ksbf2, d5ksbg2, d5ksbh2
   automated match to d1sebb1
   complexed with nag

Details for d5ksbd2

PDB Entry: 5ksb, 2.9 Å

PDB Description: t15-dq8.5-glia-gamma1 complex

PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d5ksbd2:

Sequence, based on SEQRES records:

>d5ksbd2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewr

Sequence, based on observed residues (ATOM records):

>d5ksbd2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqnpiivewr

Timeline for d5ksbd2:

• d5ksbd2 first appeared in SCOPe 2.06
  
• d5ksbd2 appears in SCOPe 2.07