| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
| Protein automated matches [254528] (17 species) not a true protein |
| Species Caldalkalibacillus thermarum [TaxId:986075] [322897] (2 PDB entries) |
| Domain d5ik2f3: 5ik2 F:350-462 [323104] Other proteins in same PDB: d5ik2a1, d5ik2a2, d5ik2b1, d5ik2b2, d5ik2c1, d5ik2c2, d5ik2d1, d5ik2d2, d5ik2e1, d5ik2e2, d5ik2f1, d5ik2f2, d5ik2g_, d5ik2i1, d5ik2i2, d5ik2j1, d5ik2j2, d5ik2k1, d5ik2k2, d5ik2l1, d5ik2l2, d5ik2m1, d5ik2m2, d5ik2n1, d5ik2n2, d5ik2o_ automated match to d2qe7d3 complexed with adp, gol, mg, po4; mutant |
PDB Entry: 5ik2 (more details), 2.6 Å
SCOPe Domain Sequences for d5ik2f3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ik2f3 a.69.1.0 (F:350-462) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
avvgeehyrvargvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhv
aeqftgmpgkyvpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl
Timeline for d5ik2f3:
View in 3DDomains from other chains: (mouse over for more information) d5ik2a1, d5ik2a2, d5ik2a3, d5ik2b1, d5ik2b2, d5ik2b3, d5ik2c1, d5ik2c2, d5ik2c3, d5ik2d1, d5ik2d2, d5ik2d3, d5ik2e1, d5ik2e2, d5ik2e3, d5ik2g_, d5ik2i1, d5ik2i2, d5ik2i3, d5ik2j1, d5ik2j2, d5ik2j3, d5ik2k1, d5ik2k2, d5ik2k3, d5ik2l1, d5ik2l2, d5ik2l3, d5ik2m1, d5ik2m2, d5ik2m3, d5ik2n1, d5ik2n2, d5ik2n3, d5ik2o_ |