Lineage for d5lp6b2 (5lp6 B:246-438)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201530Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)
  8. 2201702Domain d5lp6b2: 5lp6 B:246-438 [323100]
    Other proteins in same PDB: d5lp6a1, d5lp6b1, d5lp6c1, d5lp6d1, d5lp6e_, d5lp6f1, d5lp6f2, d5lp6f3
    automated match to d3rycd2
    complexed with 71p, ca, cl, gdp, gtp, mes, mg

Details for d5lp6b2

PDB Entry: 5lp6 (more details), 2.9 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5lp6b2:

Sequence, based on SEQRES records: (download)

>d5lp6b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d5lp6b2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsraltvpeltqqmfdsknmmaacdprhgr
yltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOPe Domain Coordinates for d5lp6b2:

Click to download the PDB-style file with coordinates for d5lp6b2.
(The format of our PDB-style files is described here.)

Timeline for d5lp6b2: