Lineage for d1g8yi_ (1g8y I:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 23599Protein Hexameric replicative helicase repA [52676] (1 species)
  7. 23600Species Escherichia coli, plasmid rsf1010 [52677] (1 PDB entry)
  8. 23609Domain d1g8yi_: 1g8y I: [32310]

Details for d1g8yi_

PDB Entry: 1g8y (more details), 2.4 Å

PDB Description: crystal structure of the hexameric replicative helicase repa of plasmid rsf1010

SCOP Domain Sequences for d1g8yi_:

Sequence, based on SEQRES records: (download)

>d1g8yi_ c.37.1.11 (I:) Hexameric replicative helicase repA {Escherichia coli, plasmid rsf1010}
athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
nygapfadrwfrrhdggvlkpa

Sequence, based on observed residues (ATOM records): (download)

>d1g8yi_ c.37.1.11 (I:) Hexameric replicative helicase repA {Escherichia coli, plasmid rsf1010}
athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
pa

SCOP Domain Coordinates for d1g8yi_:

Click to download the PDB-style file with coordinates for d1g8yi_.
(The format of our PDB-style files is described here.)

Timeline for d1g8yi_: