Lineage for d5c0zb_ (5c0z B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691340Species Norway rat (Rattus norvegicus) [TaxId:10116] [322473] (5 PDB entries)
  8. 2691342Domain d5c0zb_: 5c0z B: [323085]
    automated match to d2b4za_
    complexed with fc6, hec

Details for d5c0zb_

PDB Entry: 5c0z (more details), 1.12 Å

PDB Description: the structure of oxidized rat cytochrome c at 1.13 angstroms resolution
PDB Compounds: (B:) Cytochrome c, somatic

SCOPe Domain Sequences for d5c0zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c0zb_ a.3.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqaagfsytdanknkgitwg
edtlmeylenpkkyipgtkmifagikkkgeradliaylkkatne

SCOPe Domain Coordinates for d5c0zb_:

Click to download the PDB-style file with coordinates for d5c0zb_.
(The format of our PDB-style files is described here.)

Timeline for d5c0zb_: