Lineage for d5lp6a2 (5lp6 A:246-439)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (56 PDB entries)
  8. 2525704Domain d5lp6a2: 5lp6 A:246-439 [323084]
    Other proteins in same PDB: d5lp6a1, d5lp6b1, d5lp6c1, d5lp6d1, d5lp6e_, d5lp6f1, d5lp6f2, d5lp6f3
    automated match to d1tuba2
    complexed with 71p, ca, cl, gdp, gtp, mes, mg

Details for d5lp6a2

PDB Entry: 5lp6 (more details), 2.9 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-thiocolchicine complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5lp6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lp6a2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d5lp6a2:

Click to download the PDB-style file with coordinates for d5lp6a2.
(The format of our PDB-style files is described here.)

Timeline for d5lp6a2: