| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries) |
| Domain d5lp6a1: 5lp6 A:1-245 [323083] Other proteins in same PDB: d5lp6a2, d5lp6b2, d5lp6c2, d5lp6d2, d5lp6e_, d5lp6f1, d5lp6f2, d5lp6f3 automated match to d1tuba1 complexed with 71p, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 5lp6 (more details), 2.9 Å
SCOPe Domain Sequences for d5lp6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lp6a1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
Timeline for d5lp6a1: