SCOPe 2.07: Domain d5lp6c2: 5lp6 C:246-440

Lineage for d5lp6c2 (5lp6 C:246-440)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (72 PDB entries)

8. Domain d5lp6c2: 5lp6 C:246-440 [323078]
   Other proteins in same PDB: d5lp6a1, d5lp6b1, d5lp6c1, d5lp6d1, d5lp6e_, d5lp6f1, d5lp6f2, d5lp6f3
   automated match to d1tuba2
   complexed with 71p, ca, cl, gdp, gtp, mes, mg

Details for d5lp6c2

PDB Entry: 5lp6, 2.9 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-thiocolchicine complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5lp6c2:

Sequence; same for both SEQRES and ATOM records:

>d5lp6c2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5lp6c2:

• d5lp6c2 first appeared in SCOPe 2.06