SCOPe 2.08: Domain d5ik2k2: 5ik2 K:96-371

Lineage for d5ik2k2 (5ik2 K:96-371)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein automated matches [190393] (12 species)
   not a true protein

7. Species Caldalkalibacillus thermarum [TaxId:986075] [322910] (2 PDB entries)

8. Domain d5ik2k2: 5ik2 K:96-371 [323067]
   Other proteins in same PDB: d5ik2a1, d5ik2a3, d5ik2b1, d5ik2b3, d5ik2c1, d5ik2c3, d5ik2d1, d5ik2d3, d5ik2e1, d5ik2e3, d5ik2f1, d5ik2f3, d5ik2g_, d5ik2i1, d5ik2i3, d5ik2j1, d5ik2j3, d5ik2k1, d5ik2k3, d5ik2l1, d5ik2l3, d5ik2m1, d5ik2m3, d5ik2n1, d5ik2n3, d5ik2o_
   automated match to d1skyb3
   complexed with adp, gol, mg, po4; mutant

Details for d5ik2k2

PDB Entry: 5ik2, 2.6 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (epsilon mutant)

PDB Compounds: (K:) ATP synthase subunit alpha

SCOPe Domain Sequences for d5ik2k2:

Sequence; same for both SEQRES and ATOM records:

>d5ik2k2 c.37.1.11 (K:96-371) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
evpvgeallgrvvnplgqpldgrgpietaeyrpiespapgvmdrksvheplqtgikaids
mipigrgqreliigdrqtgkttiaidtiinqkgqdviciyvaigqkqstvagvvetlrqh
daldytivvtasasepapllylapyagcamgeyfmykgkhalvvyddlskqaaayrelsl
llrrppgreaypgdvfylhsrlleraaklsdekgggsltalpfietqagdvsayiptnvi
sitdgqiflesdlfysgvrpavnvgisvsrvggaaq

Timeline for d5ik2k2:

• d5ik2k2 first appeared in SCOPe 2.06
  
• d5ik2k2 appears in SCOPe 2.07