Lineage for d5ld8b2 (5ld8 B:260-416)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917965Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)
  8. 2918023Domain d5ld8b2: 5ld8 B:260-416 [323060]
    automated match to d2wgea2
    complexed with 6u5, na, pg4

Details for d5ld8b2

PDB Entry: 5ld8 (more details), 2.13 Å

PDB Description: gsk3011724a cocrystallised with mycobacterium tuberculosis h37rv kasa
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d5ld8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ld8b2 c.95.1.0 (B:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd
aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe
idldvvageprygdyryavnnsfgfgghnvalafgry

SCOPe Domain Coordinates for d5ld8b2:

Click to download the PDB-style file with coordinates for d5ld8b2.
(The format of our PDB-style files is described here.)

Timeline for d5ld8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ld8b1