SCOPe 2.07: Domain d5ld8a2: 5ld8 A:260-416

Lineage for d5ld8a2 (5ld8 A:260-416)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228163] (17 PDB entries)

8. Domain d5ld8a2: 5ld8 A:260-416 [323058]
   automated match to d2wgea2
   complexed with 6u5, na, pg4

Details for d5ld8a2

PDB Entry: 5ld8, 2.13 Å

PDB Description: gsk3011724a cocrystallised with mycobacterium tuberculosis h37rv kasa

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d5ld8a2:

Sequence; same for both SEQRES and ATOM records:

>d5ld8a2 c.95.1.0 (A:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd
aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe
idldvvageprygdyryavnnsfgfgghnvalafgry

Timeline for d5ld8a2:

• d5ld8a2 first appeared in SCOPe 2.06
  
• d5ld8a2 appears in the current release, SCOPe 2.08