| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries) Uniprot P08263 |
| Domain d5ld0a2: 5ld0 A:81-207 [323056] Other proteins in same PDB: d5ld0a1 automated match to d1f3aa1 complexed with cl |
PDB Entry: 5ld0 (more details), 1.6 Å
SCOPe Domain Sequences for d5ld0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ld0a2 a.45.1.1 (A:81-207) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdmkeralidmysegildltemiiqlvicppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflqp
gsqrkpa
Timeline for d5ld0a2: