Lineage for d5ld0a2 (5ld0 A:81-207)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1998829Protein Class alpha GST [81349] (8 species)
  7. 1998842Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries)
    Uniprot P08263
  8. 1998859Domain d5ld0a2: 5ld0 A:81-207 [323056]
    Other proteins in same PDB: d5ld0a1
    automated match to d1f3aa1
    complexed with cl

Details for d5ld0a2

PDB Entry: 5ld0 (more details), 1.6 Å

PDB Description: chimeric gst
PDB Compounds: (A:) Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1

SCOPe Domain Sequences for d5ld0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ld0a2 a.45.1.1 (A:81-207) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdmkeralidmysegildltemiiqlvicppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflqp
gsqrkpa

SCOPe Domain Coordinates for d5ld0a2:

Click to download the PDB-style file with coordinates for d5ld0a2.
(The format of our PDB-style files is described here.)

Timeline for d5ld0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ld0a1