SCOPe 2.08: Domain d5ld0a2: 5ld0 A:81-207

Lineage for d5ld0a2 (5ld0 A:81-207)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d5ld0a2: 5ld0 A:81-207 [323056]
   Other proteins in same PDB: d5ld0a1
   automated match to d1f3aa1
   complexed with cl

Details for d5ld0a2

PDB Entry: 5ld0, 1.6 Å

PDB Description: chimeric gst

PDB Compounds: (A:) Glutathione S-transferase A1,Glutathione S-transferase alpha-2,Glutathione S-transferase A1

SCOPe Domain Sequences for d5ld0a2:

Sequence; same for both SEQRES and ATOM records:

>d5ld0a2 a.45.1.1 (A:81-207) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdmkeralidmysegildltemiiqlvicppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflqp
gsqrkpa

Timeline for d5ld0a2:

• d5ld0a2 first appeared in SCOPe 2.06
  
• d5ld0a2 appears in SCOPe 2.07