SCOPe 2.08: Domain d5ks9b2: 5ks9 B:93-192

Lineage for d5ks9b2 (5ks9 B:93-192)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ks9b2: 5ks9 B:93-192 [323051]
   Other proteins in same PDB: d5ks9a1, d5ks9a2, d5ks9b1, d5ks9c1, d5ks9c2, d5ks9d1, d5ks9e2, d5ks9f2, d5ks9g2, d5ks9h2
   automated match to d1sebb1
   complexed with ca, nag

Details for d5ks9b2

PDB Entry: 5ks9, 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex

PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d5ks9b2:

Sequence, based on SEQRES records:

>d5ks9b2 b.1.1.0 (B:93-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqnpiivewraqs

Sequence, based on observed residues (ATOM records):

>d5ks9b2 b.1.1.0 (B:93-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqnpiivewraqs

Timeline for d5ks9b2:

• d5ks9b2 first appeared in SCOPe 2.06
  
• d5ks9b2 appears in SCOPe 2.07