SCOPe 2.08: Domain d5ksbe1: 5ksb E:2-129

Lineage for d5ksbe1 (5ksb E:2-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ksbe1: 5ksb E:2-129 [323040]
   Other proteins in same PDB: d5ksba1, d5ksba2, d5ksbb1, d5ksbc1, d5ksbc2, d5ksbd1, d5ksbe2, d5ksbf2, d5ksbg2, d5ksbh2
   automated match to d2pyfa1
   complexed with nag

Details for d5ksbe1

PDB Entry: 5ksb, 2.9 Å

PDB Description: t15-dq8.5-glia-gamma1 complex

PDB Compounds: (E:) T15 TCR alpha TRAV20*02

SCOPe Domain Sequences for d5ksbe1:

Sequence; same for both SEQRES and ATOM records:

>d5ksbe1 b.1.1.0 (E:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekeker
lkatltkkesflhitapkpedsatylcavqasggsyiptfgrgtslivhpy

Timeline for d5ksbe1:

• d5ksbe1 first appeared in SCOPe 2.06
  
• d5ksbe1 appears in SCOPe 2.07