Lineage for d5hkke3 (5hkk E:350-462)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717549Species Caldalkalibacillus thermarum [TaxId:986075] [322897] (2 PDB entries)
  8. 2717566Domain d5hkke3: 5hkk E:350-462 [323039]
    Other proteins in same PDB: d5hkka1, d5hkka2, d5hkkb1, d5hkkb2, d5hkkc1, d5hkkc2, d5hkkd1, d5hkkd2, d5hkke1, d5hkke2, d5hkkf1, d5hkkf2, d5hkkg_, d5hkki1, d5hkki2, d5hkkj1, d5hkkj2, d5hkkk1, d5hkkk2, d5hkkl1, d5hkkl2, d5hkkm1, d5hkkm2, d5hkkn1, d5hkkn2, d5hkko_
    automated match to d2qe7d3
    complexed with adp, atp, gol, mg, po4

Details for d5hkke3

PDB Entry: 5hkk (more details), 3 Å

PDB Description: caldalaklibacillus thermarum f1-atpase (wild type)
PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d5hkke3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkke3 a.69.1.0 (E:350-462) automated matches {Caldalkalibacillus thermarum [TaxId: 986075]}
avvgeehyrvargvqqvlqryndlqdiiailgmdelsdedklivararkiqrflsqpfhv
aeqftgmpgkyvpvketvrgfkeilegkhdnlpeeafymvgtideavekakkl

SCOPe Domain Coordinates for d5hkke3:

Click to download the PDB-style file with coordinates for d5hkke3.
(The format of our PDB-style files is described here.)

Timeline for d5hkke3: