SCOPe 2.07: Domain d5jfpa_: 5jfp A:

Lineage for d5jfpa_ (5jfp A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d5jfpa_: 5jfp A: [323025]
   automated match to d1sdta_
   complexed with 6kk, cl, na

Details for d5jfpa_

PDB Entry: 5jfp, 1.49 Å

PDB Description: hiv-1 wild type protease with grl-097-13a (a adamantane p1-ligand with bis-thf in p2 and isobutylamine in p1')

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5jfpa_:

Sequence; same for both SEQRES and ATOM records:

>d5jfpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d5jfpa_:

• d5jfpa_ first appeared in SCOPe 2.06
  
• d5jfpa_ appears in the current release, SCOPe 2.08