SCOPe 2.08: Domain d5ksbg2: 5ksb G:130-218

Lineage for d5ksbg2 (5ksb G:130-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5ksbg2: 5ksb G:130-218 [323023]
   Other proteins in same PDB: d5ksba1, d5ksbb1, d5ksbb2, d5ksbc1, d5ksbd1, d5ksbd2, d5ksbe1, d5ksbf1, d5ksbg1, d5ksbh1
   automated match to d2pyfa2
   complexed with nag

Details for d5ksbg2

PDB Entry: 5ksb, 2.9 Å

PDB Description: t15-dq8.5-glia-gamma1 complex

PDB Compounds: (G:) T15 TCR alpha TRAV20*02

SCOPe Domain Sequences for d5ksbg2:

Sequence; same for both SEQRES and ATOM records:

>d5ksbg2 b.1.1.2 (G:130-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d5ksbg2:

• d5ksbg2 first appeared in SCOPe 2.06
  
• d5ksbg2 appears in SCOPe 2.07