SCOPe 2.07: Domain d5ksab1: 5ksa B:2-92

Lineage for d5ksab1 (5ksa B:2-92)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)

8. Domain d5ksab1: 5ksa B:2-92 [323018]
   Other proteins in same PDB: d5ksaa2, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2
   automated match to d1klub2
   complexed with ca, nag

Details for d5ksab1

PDB Entry: 5ksa, 2 Å

PDB Description: bel602-dq8.5-glia-gamma1 complex

PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d5ksab1:

Sequence; same for both SEQRES and ATOM records:

>d5ksab1 d.19.1.0 (B:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
nsqkevlertraeldtvcrhnyqlelrttlq

Timeline for d5ksab1:

• d5ksab1 first appeared in SCOPe 2.06
  
• d5ksab1 appears in the current release, SCOPe 2.08