![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
![]() | Domain d5ksab1: 5ksa B:2-92 [323018] Other proteins in same PDB: d5ksaa2, d5ksab2, d5ksac1, d5ksac2, d5ksad1, d5ksad2 automated match to d1klub2 complexed with ca, nag |
PDB Entry: 5ksa (more details), 2 Å
SCOPe Domain Sequences for d5ksab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ksab1 d.19.1.0 (B:2-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw nsqkevlertraeldtvcrhnyqlelrttlq
Timeline for d5ksab1: