![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins) contains three domains of this fold; "Helical backbone" holds domains 2 and 3 both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 automatically mapped to Pfam PF00148 |
![]() | Protein automated matches [190199] (4 species) not a true protein |
![]() | Species Gluconacetobacter diazotrophicus [TaxId:272568] [322657] (2 PDB entries) |
![]() | Domain d5kohc_: 5koh C: [323005] Other proteins in same PDB: d5kohb_, d5kohd_ automated match to d1fp4a_ complexed with clf, fe, hca, ics, mpd, mrd |
PDB Entry: 5koh (more details), 1.83 Å
SCOPe Domain Sequences for d5kohc_:
Sequence, based on SEQRES records: (download)
>d5kohc_ c.92.2.3 (C:) automated matches {Gluconacetobacter diazotrophicus [TaxId: 272568]} dktndsafharliaevleaypdkarkrrqkhlnvagqaeaeaqdageegvmlsecdvksn vksvpgvmtirgcayagskgvvwgpvkdmvhishgpvgcgqyswsqrrnyyigntgvdsf vtmqftsdfqekdivfggdkklekiideidelfplakgisvqsecpigligddieavsrk kkkeigktivpvrcegfrgvsqslghhiandairdwvfdgedkhaafettpydvnvigdy niggdawssrilleemglrvvgnwsgdatlaeierapkaklnlihcyrsmnyicrhmeek ynipwteynffgpsqiaaslrkiaalfdekiqegaerviakyqplvdaviekfrprlagk kvmlyvgglrprhvvnayndlgmeivgtgyefghnddyqrtghyvregtliyddvtgyel ekfiegirpdlvgsgikekypvqkmgipfrqmhswdysgpyhgydgfaifardmdlainn pvwsmfkapwk
>d5kohc_ c.92.2.3 (C:) automated matches {Gluconacetobacter diazotrophicus [TaxId: 272568]} dktndsafharliaevleaypdkarkrrqkhlnvagqaegvmlsecdvksnvksvpgvmt irgcayagskgvvwgpvkdmvhishgpvgcgqyswsqrrnyyigntgvdsfvtmqftsdf qekdivfggdkklekiideidelfplakgisvqsecpigligddieavsrkkkkeigkti vpvrcegfrgvsqslghhiandairdwvfdgedkhaafettpydvnvigdyniggdawss rilleemglrvvgnwsgdatlaeierapkaklnlihcyrsmnyicrhmeekynipwteyn ffgpsqiaaslrkiaalfdekiqegaerviakyqplvdaviekfrprlagkkvmlyvggl rprhvvnayndlgmeivgtgyefghnddyqrtghyvregtliyddvtgyelekfiegirp dlvgsgikekypvqkmgipfrqmhswdysgpyhgydgfaifardmdlainnpvwsmfkap wk
Timeline for d5kohc_: