Lineage for d5jtyb_ (5jty B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. Protein automated matches [190039] (160 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. Domain d5jtyb_: 5jty B: [323004]
    Other proteins in same PDB: d5jtya_
    automated match to d4nf8b_
    complexed with 2jk, 6nd, glu

Details for d5jtyb_

PDB Entry: 5jty (more details), 2.72 Å

PDB Description: glutamate- and dcka-bound glun1/glun2a agonist binding domains with mpx-007
PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5jtyb_:

Sequence, based on SEQRES records: (download)

>d5jtyb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgy
gialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records): (download)

>d5jtyb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigifattgygia
lqkgspwkrqidlallqfvgdgemeeletlwltgic

SCOPe Domain Coordinates for d5jtyb_ are not available.

Timeline for d5jtyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5jtya_