SCOPe 2.07: Domain d5jtya_: 5jty A:

Lineage for d5jtya_ (5jty A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (33 PDB entries)

8. Domain d5jtya_: 5jty A: [323000]
   Other proteins in same PDB: d5jtyb_
   automated match to d1pb7a_
   complexed with 2jk, 6nd, glu

Details for d5jtya_

PDB Entry: 5jty, 2.72 Å

PDB Description: glutamate- and dcka-bound glun1/glun2a agonist binding domains with mpx-007

PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5jtya_:

Sequence, based on SEQRES records:

>d5jtya_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva
pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi
yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge
lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvr

Sequence, based on observed residues (ATOM records):

>d5jtya_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgphtvpqccygfcidlli
klartmnftyevhlvadgkfgtqekkewngmmgellsgqadmivapltinneraqyiefs
kpfkyqgltilvktritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmek
hnyesaaeaiqavrdnklhafiwdsavlefeaslvttgelffrsgfgigmrkdspwkqnv
slsilkshengfmedldktwvr

Timeline for d5jtya_:

• d5jtya_ first appeared in SCOPe 2.06
  
• d5jtya_ appears in the current release, SCOPe 2.08