Lineage for d5jtya_ (5jty A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [89788] (33 PDB entries)
  8. Domain d5jtya_: 5jty A: [323000]
    Other proteins in same PDB: d5jtyb_
    automated match to d1pb7a_
    complexed with 2jk, 6nd, glu

Details for d5jtya_

PDB Entry: 5jty (more details), 2.72 Å

PDB Description: glutamate- and dcka-bound glun1/glun2a agonist binding domains with mpx-007
PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5jtya_:

Sequence, based on SEQRES records: (download)

>d5jtya_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
ygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmiva
pltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdi
yfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttge
lffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvr

Sequence, based on observed residues (ATOM records): (download)

>d5jtya_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
trlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgphtvpqccygfcidlli
klartmnftyevhlvadgkfgtqekkewngmmgellsgqadmivapltinneraqyiefs
kpfkyqgltilvktritgindprlrnpsdkfiyatvkqssvdiyfrrqvelstmyrhmek
hnyesaaeaiqavrdnklhafiwdsavlefeaslvttgelffrsgfgigmrkdspwkqnv
slsilkshengfmedldktwvr

SCOPe Domain Coordinates for d5jtya_ are not available.

Timeline for d5jtya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5jtyb_