Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
Domain d5khma1: 5khm A:44-168 [322998] Other proteins in same PDB: d5khma2, d5khmb2 automated match to d4hbwa_ complexed with gol, xnh |
PDB Entry: 5khm (more details), 1.48 Å
SCOPe Domain Sequences for d5khma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5khma1 a.29.2.0 (A:44-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lptee
Timeline for d5khma1: